PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.H01058.1.p
Common NameEUGRSUZ_H01058, LOC104456713
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 379aa    MW: 42109 Da    PI: 5.2422
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.H01058.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.69e-161461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rgrWT+eEd +l++++k  G g+W++ ++  g+ R++k+c++rw +yl
  Eucgr.H01058.1.p 14 RGRWTAEEDAILLNYIKANGEGHWRSLPKNAGLLRCGKSCRLRWVNYL 61
                      8*******************************99************97 PP

2Myb_DNA-binding52.31.3e-1667112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg+ +teE+  ++++++ lG++ W++Ia++++ gRt++++k++w+++l
  Eucgr.H01058.1.p  67 RGNISTEEENVIIKLHASLGNR-WSLIASHLP-GRTDNEIKNYWNSHL 112
                       7899******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-20564IPR009057Homeodomain-like
PROSITE profilePS5129415.817961IPR017930Myb domain
SuperFamilySSF466891.08E-2711108IPR009057Homeodomain-like
SMARTSM007172.3E-121363IPR001005SANT/Myb domain
PfamPF002491.7E-131461IPR001005SANT/Myb domain
CDDcd001671.05E-81661No hitNo description
PROSITE profilePS5129425.09762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2465116IPR009057Homeodomain-like
SMARTSM007171.8E-1566114IPR001005SANT/Myb domain
PfamPF002491.4E-1467112IPR001005SANT/Myb domain
CDDcd001671.58E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051555Biological Processflavonol biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MGRAPCCEKV GLKRGRWTAE EDAILLNYIK ANGEGHWRSL PKNAGLLRCG KSCRLRWVNY  60
LRTDLRRGNI STEEENVIIK LHASLGNRWS LIASHLPGRT DNEIKNYWNS HLSRKIDTFR  120
RPSIDEALPM AMNLVKVSPP KRKGRTSRWA MKKNKNLLGP KKNPNKETSA NFDMVSSPAT  180
QPVERERLST TKASSEDRET KERESLATVN VASVPYSVGE GGTTSPLSSN NLSNPLMLSP  240
SGGREDGTIL GPLEGIDEEL SLSFNDIVDY APLLDSSGIM DVSIETSGDH EEAAAVGSGL  300
ERKSEGGEWF SCVEDDCVNW DWENHVVQGH GHDQTAEERD GQEMLAWLWE TDGGEWGSQS  360
FEEVDREKQN AMVAWLLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-24121185110B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139145PKRKGRT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00627PBMTransfer from PK06182.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.H01058.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010069870.10.0PREDICTED: myb-related protein Myb4
TrEMBLA0A059AX980.0A0A059AX98_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.15e-75myb domain protein 12